|  | Class b: All beta proteins [48724] (180 folds) | 
|  | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll | 
|  | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)  | 
|  | Family b.18.1.0: automated matches [191481] (1 protein) not a true family | 
|  | Protein automated matches [190770] (51 species) not a true protein | 
|  | Species Streptococcus pneumoniae [TaxId:170187] [193202] (7 PDB entries) | 
|  | Domain d4cuca1: 4cuc A:137-305 [413730] Other proteins in same PDB: d4cuca2, d4cuca3, d4cuca4, d4cuca5 automated match to d4cu6a1 complexed with mpd, so4 | 
PDB Entry: 4cuc (more details), 2.2 Å
SCOPe Domain Sequences for d4cuca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cuca1 b.18.1.0 (A:137-305) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
avtneevnqmiedrkvdfnqnwyfklnanskeaikpdadvstwkkldlpydwsifndfdh
espaqneggqlnggeawyrktfkldekdlkknvrltfdgvymdsqvyvngqlvghypngy
nqfsyditkylqkdgrenviavhavnkqpssrwysgsgiyrdvtlqvtd
Timeline for d4cuca1:
|  View in 3D Domains from same chain: (mouse over for more information) d4cuca2, d4cuca3, d4cuca4, d4cuca5 |