Lineage for d4cuca1 (4cuc A:137-305)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775429Species Streptococcus pneumoniae [TaxId:170187] [193202] (7 PDB entries)
  8. 2775441Domain d4cuca1: 4cuc A:137-305 [413730]
    Other proteins in same PDB: d4cuca2, d4cuca3, d4cuca4, d4cuca5
    automated match to d4cu6a1
    complexed with mpd, so4

Details for d4cuca1

PDB Entry: 4cuc (more details), 2.2 Å

PDB Description: unravelling the multiple functions of the architecturally intricate streptococcus pneumoniae beta-galactosidase, bgaa.
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d4cuca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cuca1 b.18.1.0 (A:137-305) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
avtneevnqmiedrkvdfnqnwyfklnanskeaikpdadvstwkkldlpydwsifndfdh
espaqneggqlnggeawyrktfkldekdlkknvrltfdgvymdsqvyvngqlvghypngy
nqfsyditkylqkdgrenviavhavnkqpssrwysgsgiyrdvtlqvtd

SCOPe Domain Coordinates for d4cuca1:

Click to download the PDB-style file with coordinates for d4cuca1.
(The format of our PDB-style files is described here.)

Timeline for d4cuca1:

  • d4cuca1 is new in SCOPe 2.08-stable