Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (21 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
Protein Beta-galactosidase [419186] (1 species) Pfam PF16355 inserted beta hairpin between strands 4 and 5 of canonical fold |
Species Streptococcus pneumoniae TIGR4 [TaxId:170187] [419697] (3 PDB entries) |
Domain d4cu6a5: 4cu6 A:758-865 [413719] Other proteins in same PDB: d4cu6a1, d4cu6a2, d4cu6a3, d4cu6a4 complexed with edo, so4 |
PDB Entry: 4cu6 (more details), 2.7 Å
SCOPe Domain Sequences for d4cu6a5:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cu6a5 b.1.18.2 (A:758-865) Beta-galactosidase {Streptococcus pneumoniae TIGR4 [TaxId: 170187]} kkpmvhllphwnwenkelaskvadsegkipvraysnassvelflngkslglktfnkkqts dgrtyqegananelylewkvayqpgtleaiardesgkeiardkittag
Timeline for d4cu6a5:
View in 3D Domains from same chain: (mouse over for more information) d4cu6a1, d4cu6a2, d4cu6a3, d4cu6a4 |