Lineage for d5f6hk_ (5f6h K:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2745451Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [377132] (6 PDB entries)
  8. 2745458Domain d5f6hk_: 5f6h K: [410035]
    Other proteins in same PDB: d5f6hj1, d5f6hj2, d5f6hl1, d5f6hl2, d5f6hn1, d5f6hn2, d5f6hp1, d5f6hp2
    automated match to d6shgh_

Details for d5f6hk_

PDB Entry: 5f6h (more details), 2.66 Å

PDB Description: crystal structure of tier 2 neutralizing antibody dh427 from a rhesus macaque
PDB Compounds: (K:) DH427 Antibody Heavy Chain

SCOPe Domain Sequences for d5f6hk_:

Sequence, based on SEQRES records: (download)

>d5f6hk_ b.1.1.1 (K:) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
evqlvesggglvqpggslrlscaasgftfsnsgmiwvrqapgkglewvsyislsgantyy
adsvkgrftisrdnsqntlslqmnslrvedtamyycakegwsyfdfwgqgvlvtvsgast
kgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
slssvvtvpssslgtqtyicnvnhkpsntkvdkrvep

Sequence, based on observed residues (ATOM records): (download)

>d5f6hk_ b.1.1.1 (K:) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
evqlvesggglvqpggslrlscaasgftfsnsgmiwvrqapgkglewvsyislsgantyy
adsvkgrftisrdnsqntlslqmnslrvedtamyycakegwsyfdfwgqgvlvtvsgast
kgpsvfplapgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvt
vpssslgtqtyicnvnhkpsntkvdkrvep

SCOPe Domain Coordinates for d5f6hk_:

Click to download the PDB-style file with coordinates for d5f6hk_.
(The format of our PDB-style files is described here.)

Timeline for d5f6hk_:

  • d5f6hk_ is new in SCOPe 2.08-stable