![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [377132] (6 PDB entries) |
![]() | Domain d5f6hk_: 5f6h K: [410035] Other proteins in same PDB: d5f6hj1, d5f6hj2, d5f6hl1, d5f6hl2, d5f6hn1, d5f6hn2, d5f6hp1, d5f6hp2 automated match to d6shgh_ |
PDB Entry: 5f6h (more details), 2.66 Å
SCOPe Domain Sequences for d5f6hk_:
Sequence, based on SEQRES records: (download)
>d5f6hk_ b.1.1.1 (K:) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]} evqlvesggglvqpggslrlscaasgftfsnsgmiwvrqapgkglewvsyislsgantyy adsvkgrftisrdnsqntlslqmnslrvedtamyycakegwsyfdfwgqgvlvtvsgast kgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly slssvvtvpssslgtqtyicnvnhkpsntkvdkrvep
>d5f6hk_ b.1.1.1 (K:) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]} evqlvesggglvqpggslrlscaasgftfsnsgmiwvrqapgkglewvsyislsgantyy adsvkgrftisrdnsqntlslqmnslrvedtamyycakegwsyfdfwgqgvlvtvsgast kgpsvfplapgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvt vpssslgtqtyicnvnhkpsntkvdkrvep
Timeline for d5f6hk_: