![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226133] (37 PDB entries) |
![]() | Domain d5f6hp1: 5f6h P:2-111 [280427] Other proteins in same PDB: d5f6hi_, d5f6hj2, d5f6hk_, d5f6hl2, d5f6hm_, d5f6hn2, d5f6ho_, d5f6hp2 automated match to d1aqkl1 |
PDB Entry: 5f6h (more details), 2.66 Å
SCOPe Domain Sequences for d5f6hp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f6hp1 b.1.1.0 (P:2-111) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]} saltqppsvskslgqsvtisctgtssdigaytgvswyqqhsgtaprlliydvskrpsgvs drfsgsksgntasltisglqtddeadyyccsyrtgatyifgtgtrvtvlg
Timeline for d5f6hp1: