SCOPe 2.08: Domain d5f6hp2: 5f6h P:112-213

Lineage for d5f6hp2 (5f6h P:112-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226134] (27 PDB entries)

8. Domain d5f6hp2: 5f6h P:112-213 [280428]
   Other proteins in same PDB: d5f6hi_, d5f6hj1, d5f6hk_, d5f6hl1, d5f6hm_, d5f6hn1, d5f6ho_, d5f6hp1
   automated match to d1aqkl2

Details for d5f6hp2

PDB Entry: 5f6h, 2.66 Å

PDB Description: crystal structure of tier 2 neutralizing antibody dh427 from a rhesus macaque

PDB Compounds: (P:) DH427 Antibody Light Chain

SCOPe Domain Sequences for d5f6hp2:

Sequence; same for both SEQRES and ATOM records:

>d5f6hp2 b.1.1.2 (P:112-213) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
qpkgapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapt

Timeline for d5f6hp2:

• d5f6hp2 first appeared in SCOPe 2.05
  
• d5f6hp2 appears in SCOPe 2.07