Lineage for d5f6hn1 (5f6h N:2-111)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2761531Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226133] (37 PDB entries)
  8. 2761641Domain d5f6hn1: 5f6h N:2-111 [280405]
    Other proteins in same PDB: d5f6hi_, d5f6hj2, d5f6hk_, d5f6hl2, d5f6hm_, d5f6hn2, d5f6ho_, d5f6hp2
    automated match to d1aqkl1

Details for d5f6hn1

PDB Entry: 5f6h (more details), 2.66 Å

PDB Description: crystal structure of tier 2 neutralizing antibody dh427 from a rhesus macaque
PDB Compounds: (N:) DH427 Antibody Light Chain

SCOPe Domain Sequences for d5f6hn1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f6hn1 b.1.1.0 (N:2-111) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
saltqppsvskslgqsvtisctgtssdigaytgvswyqqhsgtaprlliydvskrpsgvs
drfsgsksgntasltisglqtddeadyyccsyrtgatyifgtgtrvtvlg

SCOPe Domain Coordinates for d5f6hn1:

Click to download the PDB-style file with coordinates for d5f6hn1.
(The format of our PDB-style files is described here.)

Timeline for d5f6hn1: