Lineage for d5esvc_ (5esv C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743335Domain d5esvc_: 5esv C: [410020]
    Other proteins in same PDB: d5esvb1, d5esvb2, d5esvd1, d5esvd2, d5esvl1, d5esvl2
    automated match to d6shgh_
    complexed with nag, zn

Details for d5esvc_

PDB Entry: 5esv (more details), 3.11 Å

PDB Description: crystal structure of broadly neutralizing antibody ch03, isolated from donor ch0219, in complex with scaffolded trimeric hiv-1 env v1v2 domain from the clade c superinfecting strain of donor cap256.
PDB Compounds: (C:) CH03 Heavy Chain

SCOPe Domain Sequences for d5esvc_:

Sequence, based on SEQRES records: (download)

>d5esvc_ b.1.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesgggvvrpggslrlscaasgfifenygltwvrqvpgkglhwvsgmnwnggdtry
adsvrgrfsmsrdnsnniaylqmknlrvddtalyycargtdytiddqgifykgsgtfwyf
dlwgrgtlvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgalt
sgvhtfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep

Sequence, based on observed residues (ATOM records): (download)

>d5esvc_ b.1.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesgggvvrpggslrlscaasgfifenygltwvrqvpgkglhwvsgmnwnggdtry
adsvrgrfsmsrdnsnniaylqmknlrvddtalyycargtdytiddqgifykgsgtfwyf
dlwgrgtlvtvssastkgpsvfplapstsggtaalgclvkdyfpepvtvswnsgaltsgv
htfpavlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvep

SCOPe Domain Coordinates for d5esvc_:

Click to download the PDB-style file with coordinates for d5esvc_.
(The format of our PDB-style files is described here.)

Timeline for d5esvc_:

  • d5esvc_ is new in SCOPe 2.08-stable