Lineage for d5esvl2 (5esv L:107-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2748802Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2748803Species Human (Homo sapiens) [TaxId:9606] [88569] (147 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 2748963Domain d5esvl2: 5esv L:107-213 [280388]
    Other proteins in same PDB: d5esva_, d5esvb1, d5esvc_, d5esvd1, d5esvh_, d5esvl1
    automated match to d1dn0a2
    complexed with nag, zn

Details for d5esvl2

PDB Entry: 5esv (more details), 3.11 Å

PDB Description: crystal structure of broadly neutralizing antibody ch03, isolated from donor ch0219, in complex with scaffolded trimeric hiv-1 env v1v2 domain from the clade c superinfecting strain of donor cap256.
PDB Compounds: (L:) CH03 Light Chain

SCOPe Domain Sequences for d5esvl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5esvl2 b.1.1.2 (L:107-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d5esvl2:

Click to download the PDB-style file with coordinates for d5esvl2.
(The format of our PDB-style files is described here.)

Timeline for d5esvl2: