PDB entry 5esv

View 5esv on RCSB PDB site
Description: Crystal Structure of Broadly Neutralizing Antibody CH03, Isolated from Donor CH0219, in Complex with Scaffolded Trimeric HIV-1 Env V1V2 Domain from the Clade C Superinfecting Strain of Donor CAP256.
Class: immune system
Keywords: HIV-1, Env, V1V2, CH0219, CHAVI, scaffold, CAP256, IMMUNE SYSTEM
Deposited on 2015-11-17, released 2015-12-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-13, with a file datestamp of 2016-01-08.
Experiment type: XRAY
Resolution: 3.11 Å
R-factor: N/A
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CH03 Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5ESV (0-121)
    • Uniprot S6BGE0 (122-End)
  • Chain 'B':
    Compound: CH03 Light Chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGKC
    Database cross-references and differences (RAF-indexed):
    • PDB 5ESV (0-108)
    • Uniprot P01834 (109-End)
    Domains in SCOPe 2.07: d5esvb1, d5esvb2
  • Chain 'C':
    Compound: CH03 Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5ESV (0-121)
    • Uniprot S6BGE0 (122-End)
  • Chain 'D':
    Compound: CH03 Light Chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGKC
    Database cross-references and differences (RAF-indexed):
    • PDB 5ESV (0-108)
    • Uniprot P01834 (109-End)
    Domains in SCOPe 2.07: d5esvd1, d5esvd2
  • Chain 'E':
    Compound: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase,Envelope glycoprotein gp160
    Species: Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) [TaxId:71421]
    Gene: ispF, HI_0671
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44815 (2-13)
      • expression tag (0-1)
      • linker (14)
    • Uniprot W6ICC0 (15-84)
      • linker (88)
    • Uniprot P44815 (89-203)
      • expression tag (204-207)
  • Chain 'F':
    Compound: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase,Envelope glycoprotein gp160
    Species: Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) [TaxId:71421]
    Gene: ispF, HI_0671
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44815 (2-13)
      • expression tag (1)
      • linker (14)
    • Uniprot W6ICC0 (15-84)
    • Uniprot P44815 (89-203)
      • expression tag (204-207)
  • Chain 'G':
    Compound: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase,Envelope glycoprotein gp160
    Species: Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) [TaxId:71421]
    Gene: ispF, HI_0671
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44815 (2-13)
      • expression tag (0-1)
      • linker (14)
    • Uniprot W6ICC0 (15-84)
      • linker (87-88)
    • Uniprot P44815 (89-203)
      • expression tag (204-207)
  • Chain 'H':
    Compound: CH03 Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5ESV (0-121)
    • Uniprot S6BGE0 (122-End)
  • Chain 'L':
    Compound: CH03 Light Chain
    Species: Homo sapiens [TaxId:9606]
    Gene: IGKC
    Database cross-references and differences (RAF-indexed):
    • PDB 5ESV (0-108)
    • Uniprot P01834 (109-End)
    Domains in SCOPe 2.07: d5esvl1, d5esvl2
  • Heterogens: NAG, BMA, MAN, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5esvB (B:)
    eivltqspatlslspgeratlscrasqsvhpkyfawyqqkpgqsprlliysgstraagia
    drfsgggsgihftltitrvepedfavyfcqqyggspytfgqgtkvelrrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5esvB (B:)
    eivltqspatlslspgeratlscrasqsvhpkyfawyqqkpgqsprlliysgstraagia
    drfsgggsgihftltitrvepedfavyfcqqyggspytfgqgtkvelrrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5esvD (D:)
    eivltqspatlslspgeratlscrasqsvhpkyfawyqqkpgqsprlliysgstraagia
    drfsgggsgihftltitrvepedfavyfcqqyggspytfgqgtkvelrrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5esvD (D:)
    eivltqspatlslspgeratlscrasqsvhpkyfawyqqkpgqsprlliysgstraagia
    drfsgggsgihftltitrvepedfavyfcqqyggspytfgqgtkvelrrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5esvL (L:)
    eivltqspatlslspgeratlscrasqsvhpkyfawyqqkpgqsprlliysgstraagia
    drfsgggsgihftltitrvepedfavyfcqqyggspytfgqgtkvelrrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5esvL (L:)
    eivltqspatlslspgeratlscrasqsvhpkyfawyqqkpgqsprlliysgstraagia
    drfsgggsgihftltitrvepedfavyfcqqyggspytfgqgtkvelrrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrge