Lineage for d5esvd1 (5esv D:1-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2758438Domain d5esvd1: 5esv D:1-106 [280383]
    Other proteins in same PDB: d5esva_, d5esvb2, d5esvc_, d5esvd2, d5esvh_, d5esvl2
    automated match to d1dn0a1
    complexed with nag, zn

Details for d5esvd1

PDB Entry: 5esv (more details), 3.11 Å

PDB Description: crystal structure of broadly neutralizing antibody ch03, isolated from donor ch0219, in complex with scaffolded trimeric hiv-1 env v1v2 domain from the clade c superinfecting strain of donor cap256.
PDB Compounds: (D:) CH03 Light Chain

SCOPe Domain Sequences for d5esvd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5esvd1 b.1.1.0 (D:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspatlslspgeratlscrasqsvhpkyfawyqqkpgqsprlliysgstraagia
drfsgggsgihftltitrvepedfavyfcqqyggspytfgqgtkvel

SCOPe Domain Coordinates for d5esvd1:

Click to download the PDB-style file with coordinates for d5esvd1.
(The format of our PDB-style files is described here.)

Timeline for d5esvd1: