![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Llama glama [TaxId:9844] [236993] (3 PDB entries) |
![]() | Domain d4o9hh_: 4o9h H: [409282] Other proteins in same PDB: d4o9ha_, d4o9hl1, d4o9hl2 automated match to d6shgh_ |
PDB Entry: 4o9h (more details), 2.42 Å
SCOPe Domain Sequences for d4o9hh_:
Sequence, based on SEQRES records: (download)
>d4o9hh_ b.1.1.1 (H:) automated matches {Llama glama [TaxId: 9844]} evqlvesggglvqpggslrlscaasgftfssyrmywvrqppgkglewvsaisagggstyy gdsvkgrftisrdnakntvylqmnslkpedtavyycanragwgmgdywgqgtqvtvssas tkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks
>d4o9hh_ b.1.1.1 (H:) automated matches {Llama glama [TaxId: 9844]} evqlvesggglvqpggslrlscaasgftfssyrmywvrqppgkglewvsaisagggstyy gdsvkgrftisrdnakntvylqmnslkpedtavyycanragwgmgdywgqgtqvtvssas tkgpsvfplapssktaalgclvkdyfpepvtvswngvhtfpavlqssglyslssvvttyi cnvnhkpsntkvdkkvepks
Timeline for d4o9hh_: