Lineage for d4o9hh_ (4o9h H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744165Species Llama glama [TaxId:9844] [236993] (3 PDB entries)
  8. 2744173Domain d4o9hh_: 4o9h H: [409282]
    Other proteins in same PDB: d4o9ha_, d4o9hl1, d4o9hl2
    automated match to d6shgh_

Details for d4o9hh_

PDB Entry: 4o9h (more details), 2.42 Å

PDB Description: structure of interleukin-6 in complex with a camelid fab fragment
PDB Compounds: (H:) Heavy Chain of the Camelid Fab fragment 61H7

SCOPe Domain Sequences for d4o9hh_:

Sequence, based on SEQRES records: (download)

>d4o9hh_ b.1.1.1 (H:) automated matches {Llama glama [TaxId: 9844]}
evqlvesggglvqpggslrlscaasgftfssyrmywvrqppgkglewvsaisagggstyy
gdsvkgrftisrdnakntvylqmnslkpedtavyycanragwgmgdywgqgtqvtvssas
tkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgl
yslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks

Sequence, based on observed residues (ATOM records): (download)

>d4o9hh_ b.1.1.1 (H:) automated matches {Llama glama [TaxId: 9844]}
evqlvesggglvqpggslrlscaasgftfssyrmywvrqppgkglewvsaisagggstyy
gdsvkgrftisrdnakntvylqmnslkpedtavyycanragwgmgdywgqgtqvtvssas
tkgpsvfplapssktaalgclvkdyfpepvtvswngvhtfpavlqssglyslssvvttyi
cnvnhkpsntkvdkkvepks

SCOPe Domain Coordinates for d4o9hh_:

Click to download the PDB-style file with coordinates for d4o9hh_.
(The format of our PDB-style files is described here.)

Timeline for d4o9hh_:

  • d4o9hh_ is new in SCOPe 2.08-stable