Lineage for d4o9hl1 (4o9h L:1-110)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759475Species Llama glama [TaxId:9844] [271448] (2 PDB entries)
  8. 2759477Domain d4o9hl1: 4o9h L:1-110 [271449]
    Other proteins in same PDB: d4o9ha_, d4o9hh_, d4o9hl2
    automated match to d1aqkl1

Details for d4o9hl1

PDB Entry: 4o9h (more details), 2.42 Å

PDB Description: structure of interleukin-6 in complex with a camelid fab fragment
PDB Compounds: (L:) Light Chain of the Camelid Fab fragment 61H7

SCOPe Domain Sequences for d4o9hl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o9hl1 b.1.1.0 (L:1-110) automated matches {Llama glama [TaxId: 9844]}
qtvvtqepslsvspggtvtltcglssgsvtasnypgwfqqtpgqapraliystndrhsgv
psrfsgsisgnkaaltitgaqpedeadyycaldigditefgggthltvlg

SCOPe Domain Coordinates for d4o9hl1:

Click to download the PDB-style file with coordinates for d4o9hl1.
(The format of our PDB-style files is described here.)

Timeline for d4o9hl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4o9hl2