Lineage for d4o9ha_ (4o9h A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705449Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)
  6. 2705489Protein Interleukin-6 [47272] (2 species)
  7. 2705490Species Human (Homo sapiens) [TaxId:9606] [47273] (9 PDB entries)
  8. 2705495Domain d4o9ha_: 4o9h A: [271394]
    Other proteins in same PDB: d4o9hh_, d4o9hl1, d4o9hl2
    automated match to d1alua_

Details for d4o9ha_

PDB Entry: 4o9h (more details), 2.42 Å

PDB Description: structure of interleukin-6 in complex with a camelid fab fragment
PDB Compounds: (A:) interleukin-6

SCOPe Domain Sequences for d4o9ha_:

Sequence, based on SEQRES records: (download)

>d4o9ha_ a.26.1.1 (A:) Interleukin-6 {Human (Homo sapiens) [TaxId: 9606]}
ltsseridkqiryildgisalrketcnksnmcesskealaennlnlpkmaekdgcfqsgf
neetclvkiitgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknldaitt
pdpttnaslltklqaqnqwlqdmtthlilrsfkeflqsslralrqm

Sequence, based on observed residues (ATOM records): (download)

>d4o9ha_ a.26.1.1 (A:) Interleukin-6 {Human (Homo sapiens) [TaxId: 9606]}
ltsseridkqiryildgisalrketcnksnnlnlpkmaekdgcfqsgfneetclvkiitg
llefevyleylqnrsseeqaravqmstkvliqflqkkaknldaittpdpttnaslltklq
aqnqwlqdmtthlilrsfkeflqsslralrqm

SCOPe Domain Coordinates for d4o9ha_:

Click to download the PDB-style file with coordinates for d4o9ha_.
(The format of our PDB-style files is described here.)

Timeline for d4o9ha_: