![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
![]() | Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
![]() | Family a.26.1.1: Long-chain cytokines [47267] (10 proteins) |
![]() | Protein Interleukin-6 [47272] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47273] (9 PDB entries) |
![]() | Domain d4o9ha_: 4o9h A: [271394] Other proteins in same PDB: d4o9hh_, d4o9hl1, d4o9hl2 automated match to d1alua_ |
PDB Entry: 4o9h (more details), 2.42 Å
SCOPe Domain Sequences for d4o9ha_:
Sequence, based on SEQRES records: (download)
>d4o9ha_ a.26.1.1 (A:) Interleukin-6 {Human (Homo sapiens) [TaxId: 9606]} ltsseridkqiryildgisalrketcnksnmcesskealaennlnlpkmaekdgcfqsgf neetclvkiitgllefevyleylqnrfesseeqaravqmstkvliqflqkkaknldaitt pdpttnaslltklqaqnqwlqdmtthlilrsfkeflqsslralrqm
>d4o9ha_ a.26.1.1 (A:) Interleukin-6 {Human (Homo sapiens) [TaxId: 9606]} ltsseridkqiryildgisalrketcnksnnlnlpkmaekdgcfqsgfneetclvkiitg llefevyleylqnrsseeqaravqmstkvliqflqkkaknldaittpdpttnaslltklq aqnqwlqdmtthlilrsfkeflqsslralrqm
Timeline for d4o9ha_: