![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily) |
![]() | Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) ![]() |
![]() | Family d.97.1.1: Cell cycle regulatory proteins [55638] (4 proteins) |
![]() | Protein suc1 [55639] (1 species) |
![]() | Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [55640] (2 PDB entries) |
![]() | Domain d1sceb_: 1sce B: [40677] |
PDB Entry: 1sce (more details), 2.2 Å
SCOP Domain Sequences for d1sceb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sceb_ d.97.1.1 (B:) suc1 {Fission yeast (Schizosaccharomyces pombe)} vprlltasererlepfidqihyspryaddeyeyrhvmlpkamlkaiptdyfnpetgtlri lqeeewrglgitqslgwemyevhvpephillfkrekd
Timeline for d1sceb_: