Lineage for d1scec_ (1sce C:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 34875Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily)
  4. 34876Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family) (S)
  5. 34877Family d.97.1.1: Cell cycle regulatory proteins [55638] (4 proteins)
  6. 34895Protein suc1 [55639] (1 species)
  7. 34896Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [55640] (2 PDB entries)
  8. 34900Domain d1scec_: 1sce C: [40678]

Details for d1scec_

PDB Entry: 1sce (more details), 2.2 Å

PDB Description: crystal structure of the cell cycle regulatory protein suc1 reveals a novel beta-hinge conformational switch

SCOP Domain Sequences for d1scec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1scec_ d.97.1.1 (C:) suc1 {Fission yeast (Schizosaccharomyces pombe)}
sksgvprlltasererlepfidqihyspryaddeyeyrhvmlpkamlkaiptdyfnpetg
tlrilqeeewrglgitqslgwemyevhvpephillfkrekdyqmksqqrgg

SCOP Domain Coordinates for d1scec_:

Click to download the PDB-style file with coordinates for d1scec_.
(The format of our PDB-style files is described here.)

Timeline for d1scec_: