SCOP 1.55: Domain d1sced_: 1sce D:

Lineage for d1sced_ (1sce D:)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.97: Cell cycle regulatory proteins [55636] (1 superfamily)

4. Superfamily d.97.1: Cell cycle regulatory proteins [55637] (1 family)

5. Family d.97.1.1: Cell cycle regulatory proteins [55638] (4 proteins)

6. Protein suc1 [55639] (1 species)

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [55640] (2 PDB entries)

8. Domain d1sced_: 1sce D: [40679]

Details for d1sced_

PDB Entry: 1sce, 2.2 Å

PDB Description: crystal structure of the cell cycle regulatory protein suc1 reveals a novel beta-hinge conformational switch

SCOP Domain Sequences for d1sced_:

Sequence; same for both SEQRES and ATOM records:

>d1sced_ d.97.1.1 (D:) suc1 {Fission yeast (Schizosaccharomyces pombe)}
ksgvprlltasererlepfidqihyspryaddeyeyrhvmlpkamlkaiptdyfnpetgt
lrilqeeewrglgitqslgwemyevhvpephillfkrekdyqm

Timeline for d1sced_:

• d1sced_ appears in SCOP 1.57
  
• d1sced_ appears in the current release, SCOPe 2.08