SCOPe 2.08: Domain d6wvzm2: 6wvz M:516-564

Lineage for d6wvzm2 (6wvz M:516-564)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.16: Trefoil/Plexin domain-like [57491] (3 superfamilies)
   disulfide-rich fold; common core is alpha+beta with two conserved disulfides

4. Superfamily g.16.2: Plexin repeat [103575] (1 family)

5. Family g.16.2.1: Plexin repeat [103576] (3 proteins)
   Pfam PF01437

6. Protein Hepatocyte growth factor receptor [111407] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [111408] (3 PDB entries)
   Uniprot P08581 40-564

8. Domain d6wvzm2: 6wvz M:516-564 [404170]
   Other proteins in same PDB: d6wvzh_, d6wvzl1, d6wvzl2, d6wvzm1, d6wvzm3
   automated match to d1shyb2
   complexed with fmt, nag

Details for d6wvzm2

PDB Entry: 6wvz, 3.1 Å

PDB Description: crystal structure of anti-met fab arm of amivantamab in complex with human met

PDB Compounds: (M:) Hepatocyte growth factor receptor

SCOPe Domain Sequences for d6wvzm2:

Sequence; same for both SEQRES and ATOM records:

>d6wvzm2 g.16.2.1 (M:516-564) Hepatocyte growth factor receptor {Human (Homo sapiens) [TaxId: 9606]}
nglgcrhfqscsqclsappfvqcgwchdkcvrseeclsgtwtqqiclpa

Timeline for d6wvzm2:

• d6wvzm2 first appeared in SCOPe 2.07