Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d6wvzh_: 6wvz H: [412139] Other proteins in same PDB: d6wvzl2, d6wvzm1, d6wvzm2, d6wvzm3 automated match to d6shgh_ complexed with fmt, nag |
PDB Entry: 6wvz (more details), 3.1 Å
SCOPe Domain Sequences for d6wvzh_:
Sequence, based on SEQRES records: (download)
>d6wvzh_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qvqlvqsgaevkkpgasvkvscetsgytftsygiswvrqapghglewmgwisayngytny aqklqgrvtmttdtststaymelrslrsddtavyycardlrgtnyfdywgqgtlvtvssa stkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssg lyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepksc
>d6wvzh_ b.1.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qvqlvqsgaevkkpgasvkvscetsgytftsygiswvrqapghglewmgwisayngytny aqklqgrvtmttdtststaymelrslrsddtavyycardlrgtnyfdywgqgtlvtvssa stkgpsvfplapgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssv vtvpssslgtqtyicnvnhkpsntkvdkrvepksc
Timeline for d6wvzh_: