Lineage for d6tmhg_ (6tmh g:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2488765Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 2488928Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families) (S)
    contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold
  5. 2488973Family c.49.2.0: automated matches [191450] (1 protein)
    not a true family
  6. 2488974Protein automated matches [190687] (6 species)
    not a true protein
  7. 2489004Species Toxoplasma gondii [TaxId:507601] [397895] (1 PDB entry)
  8. 2489005Domain d6tmhg_: 6tmh g: [397896]
    Other proteins in same PDB: d6tmha1, d6tmha2, d6tmha3, d6tmhb1, d6tmhb2, d6tmhb3, d6tmhc1, d6tmhc2, d6tmhc3, d6tmhd1, d6tmhd2, d6tmhd3, d6tmhe1, d6tmhe2, d6tmhe3, d6tmhf1, d6tmhf2, d6tmhf3
    automated match to d2jdig_
    complexed with adp, atp, mg

Details for d6tmhg_

PDB Entry: 6tmh (more details), 3.1 Å

PDB Description: cryo-em structure of toxoplasma gondii mitochondrial atp synthase dimer, oscp/f1/c-ring model
PDB Compounds: (g:) ATP synthase subunit gamma

SCOPe Domain Sequences for d6tmhg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tmhg_ c.49.2.0 (g:) automated matches {Toxoplasma gondii [TaxId: 507601]}
dlkivaarmksvksiqkitkamkmvaasklrmdqrrlenglpfatpvqklvqripvdpke
kgtlavlalssdkglcggvnsfvakqarivikenemagnavqvygvgdkirsalqrtfgd
rfkrimtevtrfpwnfgqaciiadrlmqdnparlmviynhfksavaydtltlnvltptqa
aqsakeqlntfefepektdvwkdlqdfyyactvfgcmldniaseqsarmsamdnastnag
emissltlrynrarqakittelveiisganal

SCOPe Domain Coordinates for d6tmhg_:

Click to download the PDB-style file with coordinates for d6tmhg_.
(The format of our PDB-style files is described here.)

Timeline for d6tmhg_: