Lineage for d6tmhb2 (6tmh B:153-436)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479613Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2479614Protein automated matches [190123] (156 species)
    not a true protein
  7. 2481118Species Toxoplasma gondii [TaxId:507601] [397665] (1 PDB entry)
  8. 2481119Domain d6tmhb2: 6tmh B:153-436 [397709]
    Other proteins in same PDB: d6tmha1, d6tmha2, d6tmha3, d6tmhb1, d6tmhb3, d6tmhc1, d6tmhc2, d6tmhc3, d6tmhd1, d6tmhd3, d6tmhe1, d6tmhe2, d6tmhe3, d6tmhf1, d6tmhf3, d6tmhg_
    automated match to d1mabb3
    complexed with adp, atp, mg

Details for d6tmhb2

PDB Entry: 6tmh (more details), 3.1 Å

PDB Description: cryo-em structure of toxoplasma gondii mitochondrial atp synthase dimer, oscp/f1/c-ring model
PDB Compounds: (B:) ATP synthase subunit beta

SCOPe Domain Sequences for d6tmhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tmhb2 c.37.1.0 (B:153-436) automated matches {Toxoplasma gondii [TaxId: 507601]}
iqvpvgvetlgrimnvigepvdecgpvpakktysihraaplfadqstepgllqtgikvvd
llapyakggkiglfggagvgktvlimelinnvankhggfsvfagvgertregndlyhemm
ttgvikrkkledgkfdftgskaalvygqmneppgararvaltalsvaeyfrdeqgqdvll
fidniyrftqagsevsallgripsavgyqptlatdlgqlqeritttkkgsitsvqavyvp
addltdpapattfahldattvlsrqiaelgiypavdpldstsrm

SCOPe Domain Coordinates for d6tmhb2:

Click to download the PDB-style file with coordinates for d6tmhb2.
(The format of our PDB-style files is described here.)

Timeline for d6tmhb2: