Lineage for d6tmhe2 (6tmh E:146-431)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2477556Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (21 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 2478123Protein automated matches [190393] (13 species)
    not a true protein
  7. 2478248Species Toxoplasma gondii [TaxId:507601] [397690] (1 PDB entry)
  8. 2478251Domain d6tmhe2: 6tmh E:146-431 [397691]
    Other proteins in same PDB: d6tmha1, d6tmha3, d6tmhb1, d6tmhb2, d6tmhb3, d6tmhc1, d6tmhc3, d6tmhd1, d6tmhd2, d6tmhd3, d6tmhe1, d6tmhe3, d6tmhf1, d6tmhf2, d6tmhf3, d6tmhg_
    automated match to d1maba3
    complexed with adp, atp, mg

Details for d6tmhe2

PDB Entry: 6tmh (more details), 3.1 Å

PDB Description: cryo-em structure of toxoplasma gondii mitochondrial atp synthase dimer, oscp/f1/c-ring model
PDB Compounds: (E:) ATP synthase subunit alpha,subunit alpha

SCOPe Domain Sequences for d6tmhe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tmhe2 c.37.1.11 (E:146-431) automated matches {Toxoplasma gondii [TaxId: 507601]}
vdvpigpgllgrvvdalgnpidgkgpipakerrrvelkapgiiprksvhepmmtglkcvd
alvpvgrgqreliigdrqtgktavavdaiinqkeindstddeskklyciyvavgqkrstv
aqivkaleqrdamkyttvvaataseaaplqflapysgcamgewfrdsgrhcviiyddlsk
qatayrqmslllrrppgreaypgdvfylhsrlleraakmgdksgggsltalpvietqagd
vsayiptnvisitdgqifletelfykgirpainvglsvsrvgsaaq

SCOPe Domain Coordinates for d6tmhe2:

Click to download the PDB-style file with coordinates for d6tmhe2.
(The format of our PDB-style files is described here.)

Timeline for d6tmhe2: