Lineage for d6zjca1 (6zjc A:3-80)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879598Species Horse (Equus caballus) [TaxId:9796] [396656] (2 PDB entries)
  8. 2879599Domain d6zjca1: 6zjc A:3-80 [396786]
    Other proteins in same PDB: d6zjca2, d6zjcb2, d6zjcc2, d6zjcd2
    automated match to d1gsea2
    complexed with gsh, mpd, qlt

Details for d6zjca1

PDB Entry: 6zjc (more details), 2.2 Å

PDB Description: crystal structure of equus ferus caballus glutathione transferase a3-3 in complex with glutathione and triethyltin
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d6zjca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zjca1 c.47.1.0 (A:3-80) automated matches {Horse (Equus caballus) [TaxId: 9796]}
vkpmlhyfngrgrmepirwllaaagvefeetfidtpedfeklkndgslmfqqvpmveidg
mklvqsrailnyvaakhn

SCOPe Domain Coordinates for d6zjca1:

Click to download the PDB-style file with coordinates for d6zjca1.
(The format of our PDB-style files is described here.)

Timeline for d6zjca1: