SCOPe 2.08: Domain d6zjca2: 6zjc A:81-222

Lineage for d6zjca2 (6zjc A:81-222)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein automated matches [226848] (14 species)
   not a true protein

7. Species Horse (Equus caballus) [TaxId:9796] [396658] (2 PDB entries)

8. Domain d6zjca2: 6zjc A:81-222 [396787]
   Other proteins in same PDB: d6zjca1, d6zjcb1, d6zjcc1, d6zjcd1
   automated match to d1k3ya1
   complexed with gsh, mpd, qlt

Details for d6zjca2

PDB Entry: 6zjc, 2.2 Å

PDB Description: crystal structure of equus ferus caballus glutathione transferase a3-3 in complex with glutathione and triethyltin

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d6zjca2:

Sequence; same for both SEQRES and ATOM records:

>d6zjca2 a.45.1.1 (A:81-222) automated matches {Horse (Equus caballus) [TaxId: 9796]}
lygkdikeralidmyiegvadlnemilllpitppaekdakimlikdrttnrylpafekvl
kshgedylvgnrlsradihlvellylveeldpslltnfpllkalkarisnlptvkkflqp
ggarkppgdeksveksrkifkf

Timeline for d6zjca2:

• d6zjca2 first appeared in SCOPe 2.07