SCOPe 2.08: Domain d6zjcc1: 6zjc C:3-80

Lineage for d6zjcc1 (6zjc C:3-80)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Horse (Equus caballus) [TaxId:9796] [396656] (2 PDB entries)

8. Domain d6zjcc1: 6zjc C:3-80 [396769]
   Other proteins in same PDB: d6zjca2, d6zjcb2, d6zjcc2, d6zjcd2
   automated match to d1gsea2
   complexed with gsh, mpd, qlt

Details for d6zjcc1

PDB Entry: 6zjc, 2.2 Å

PDB Description: crystal structure of equus ferus caballus glutathione transferase a3-3 in complex with glutathione and triethyltin

PDB Compounds: (C:) glutathione s-transferase

SCOPe Domain Sequences for d6zjcc1:

Sequence; same for both SEQRES and ATOM records:

>d6zjcc1 c.47.1.0 (C:3-80) automated matches {Horse (Equus caballus) [TaxId: 9796]}
vkpmlhyfngrgrmepirwllaaagvefeetfidtpedfeklkndgslmfqqvpmveidg
mklvqsrailnyvaakhn

Timeline for d6zjcc1:

• d6zjcc1 first appeared in SCOPe 2.07