| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (188 species) not a true protein |
| Species Equus caballus [TaxId:9796] [396656] (2 PDB entries) |
| Domain d6zjca1: 6zjc A:3-80 [396786] Other proteins in same PDB: d6zjca2, d6zjcb2, d6zjcc2, d6zjcd2 automated match to d1gsea2 complexed with gsh, mpd, qlt |
PDB Entry: 6zjc (more details), 2.2 Å
SCOPe Domain Sequences for d6zjca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zjca1 c.47.1.0 (A:3-80) automated matches {Equus caballus [TaxId: 9796]}
vkpmlhyfngrgrmepirwllaaagvefeetfidtpedfeklkndgslmfqqvpmveidg
mklvqsrailnyvaakhn
Timeline for d6zjca1: