Lineage for d6zjcc2 (6zjc C:81-222)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325989Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2325990Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2325991Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2326706Protein automated matches [226848] (13 species)
    not a true protein
  7. 2326717Species Equus caballus [TaxId:9796] [396658] (2 PDB entries)
  8. 2326720Domain d6zjcc2: 6zjc C:81-222 [396770]
    Other proteins in same PDB: d6zjca1, d6zjcb1, d6zjcc1, d6zjcd1
    automated match to d1k3ya1
    complexed with gsh, mpd, qlt

Details for d6zjcc2

PDB Entry: 6zjc (more details), 2.2 Å

PDB Description: crystal structure of equus ferus caballus glutathione transferase a3-3 in complex with glutathione and triethyltin
PDB Compounds: (C:) glutathione s-transferase

SCOPe Domain Sequences for d6zjcc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zjcc2 a.45.1.1 (C:81-222) automated matches {Equus caballus [TaxId: 9796]}
lygkdikeralidmyiegvadlnemilllpitppaekdakimlikdrttnrylpafekvl
kshgedylvgnrlsradihlvellylveeldpslltnfpllkalkarisnlptvkkflqp
ggarkppgdeksveksrkifkf

SCOPe Domain Coordinates for d6zjcc2:

Click to download the PDB-style file with coordinates for d6zjcc2.
(The format of our PDB-style files is described here.)

Timeline for d6zjcc2: