Lineage for d6zjcc1 (6zjc C:3-80)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486890Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2486891Protein automated matches [190056] (188 species)
    not a true protein
  7. 2487380Species Equus caballus [TaxId:9796] [396656] (2 PDB entries)
  8. 2487383Domain d6zjcc1: 6zjc C:3-80 [396769]
    Other proteins in same PDB: d6zjca2, d6zjcb2, d6zjcc2, d6zjcd2
    automated match to d1gsea2
    complexed with gsh, mpd, qlt

Details for d6zjcc1

PDB Entry: 6zjc (more details), 2.2 Å

PDB Description: crystal structure of equus ferus caballus glutathione transferase a3-3 in complex with glutathione and triethyltin
PDB Compounds: (C:) glutathione s-transferase

SCOPe Domain Sequences for d6zjcc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zjcc1 c.47.1.0 (C:3-80) automated matches {Equus caballus [TaxId: 9796]}
vkpmlhyfngrgrmepirwllaaagvefeetfidtpedfeklkndgslmfqqvpmveidg
mklvqsrailnyvaakhn

SCOPe Domain Coordinates for d6zjcc1:

Click to download the PDB-style file with coordinates for d6zjcc1.
(The format of our PDB-style files is described here.)

Timeline for d6zjcc1: