Lineage for d6zlfi2 (6zlf I:256-408)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2464623Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2465166Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2465167Protein automated matches [190158] (30 species)
    not a true protein
  7. 2465288Species Methanothermococcus thermolithotrophicus [TaxId:2186] [358263] (4 PDB entries)
  8. 2465293Domain d6zlfi2: 6zlf I:256-408 [396669]
    Other proteins in same PDB: d6zlfa1, d6zlff1, d6zlfg1, d6zlfh1, d6zlfi1, d6zlfj1, d6zlfk1, d6zlfl1
    automated match to d2ohha2
    complexed with cl, feo, fmn, hez, kr

Details for d6zlfi2

PDB Entry: 6zlf (more details), 1.8 Å

PDB Description: aerobic crystal structure of f420h2-oxidase from methanothermococcus thermolithotrophicus at 1.8a resolution under 125 bars of krypton
PDB Compounds: (I:) Coenzyme F420H2 oxidase (FprA)

SCOPe Domain Sequences for d6zlfi2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zlfi2 c.23.5.0 (I:256-408) automated matches {Methanothermococcus thermolithotrophicus [TaxId: 2186]}
ckdkvtivydtmhgstqkmahafaegimsegvdvkmyflhnderseivkdildskafllg
aptiydepfpsvgdliyylkglkfnrtglkrlalafgsmggngggtkvlaeklkecgfev
ldeyelyyvptedelekcynmgkrlavkvkemk

SCOPe Domain Coordinates for d6zlfi2:

Click to download the PDB-style file with coordinates for d6zlfi2.
(The format of our PDB-style files is described here.)

Timeline for d6zlfi2: