SCOPe 2.07: Domain d6zlfh2: 6zlf H:256-408

Lineage for d6zlfh2 (6zlf H:256-408)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.0: automated matches [191330] (1 protein)
   not a true family

6. Protein automated matches [190158] (30 species)
   not a true protein

7. Species Methanothermococcus thermolithotrophicus [TaxId:2186] [358263] (4 PDB entries)

8. Domain d6zlfh2: 6zlf H:256-408 [396681]
   Other proteins in same PDB: d6zlfa1, d6zlff1, d6zlfg1, d6zlfh1, d6zlfi1, d6zlfj1, d6zlfk1, d6zlfl1
   automated match to d2ohha2
   complexed with cl, feo, fmn, hez, kr

Details for d6zlfh2

PDB Entry: 6zlf, 1.8 Å

PDB Description: aerobic crystal structure of f420h2-oxidase from methanothermococcus thermolithotrophicus at 1.8a resolution under 125 bars of krypton

PDB Compounds: (H:) Coenzyme F420H2 oxidase (FprA)

SCOPe Domain Sequences for d6zlfh2:

Sequence; same for both SEQRES and ATOM records:

>d6zlfh2 c.23.5.0 (H:256-408) automated matches {Methanothermococcus thermolithotrophicus [TaxId: 2186]}
ckdkvtivydtmhgstqkmahafaegimsegvdvkmyflhnderseivkdildskafllg
aptiydepfpsvgdliyylkglkfnrtglkrlalafgsmggngggtkvlaeklkecgfev
ldeyelyyvptedelekcynmgkrlavkvkemk

Timeline for d6zlfh2:

• d6zlfh2 is new in SCOPe 2.07-stable
  
• d6zlfh2 appears in the current release, SCOPe 2.08