![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) ![]() |
![]() | Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
![]() | Protein automated matches [190418] (31 species) not a true protein |
![]() | Species Methanothermococcus thermolithotrophicus [TaxId:2186] [358261] (4 PDB entries) |
![]() | Domain d6zlfg1: 6zlf G:1-255 [396674] Other proteins in same PDB: d6zlfa2, d6zlff2, d6zlfg2, d6zlfh2, d6zlfi2, d6zlfj2, d6zlfk2, d6zlfl2 automated match to d2ohha1 complexed with cl, feo, fmn, hez, kr |
PDB Entry: 6zlf (more details), 1.8 Å
SCOPe Domain Sequences for d6zlfg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zlfg1 d.157.1.0 (G:1-255) automated matches {Methanothermococcus thermolithotrophicus [TaxId: 2186]} mkadavkiadgvywvgvldwdirmyhgytlngttynaylvfgddkvalidntypgtsaqm wgrikdacekegrefkidvivqnhvekdhsgalpeihkkfpeapiyctevaveglvkhfp slkgapfkvvkslesidlggktltfleapllhwpdsmftlyaeegilfsndafgqhlcft qrfdheipenilmdanqkfyanlitplsklvlkkfkevielgllekikmiapshgqiwtd pmkvigayqdfatgk
Timeline for d6zlfg1: