Lineage for d6zlff1 (6zlf F:1-255)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2603526Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2603527Protein automated matches [190418] (31 species)
    not a true protein
  7. 2603824Species Methanothermococcus thermolithotrophicus [TaxId:2186] [358261] (4 PDB entries)
  8. 2603826Domain d6zlff1: 6zlf F:1-255 [396689]
    Other proteins in same PDB: d6zlfa2, d6zlff2, d6zlfg2, d6zlfh2, d6zlfi2, d6zlfj2, d6zlfk2, d6zlfl2
    automated match to d2ohha1
    complexed with cl, feo, fmn, hez, kr

Details for d6zlff1

PDB Entry: 6zlf (more details), 1.8 Å

PDB Description: aerobic crystal structure of f420h2-oxidase from methanothermococcus thermolithotrophicus at 1.8a resolution under 125 bars of krypton
PDB Compounds: (F:) Coenzyme F420H2 oxidase (FprA)

SCOPe Domain Sequences for d6zlff1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zlff1 d.157.1.0 (F:1-255) automated matches {Methanothermococcus thermolithotrophicus [TaxId: 2186]}
mkadavkiadgvywvgvldwdirmyhgytlngttynaylvfgddkvalidntypgtsaqm
wgrikdacekegrefkidvivqnhvekdhsgalpeihkkfpeapiyctevaveglvkhfp
slkgapfkvvkslesidlggktltfleapllhwpdsmftlyaeegilfsndafgqhlcft
qrfdheipenilmdanqkfyanlitplsklvlkkfkevielgllekikmiapshgqiwtd
pmkvigayqdfatgk

SCOPe Domain Coordinates for d6zlff1:

Click to download the PDB-style file with coordinates for d6zlff1.
(The format of our PDB-style files is described here.)

Timeline for d6zlff1: