SCOPe 2.08: Domain d6ymxe1: 6ymx E:31-86

Lineage for d6ymxe1 (6ymx E:31-86)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families)

5. Family f.23.12.0: automated matches [254198] (1 protein)
   not a true family

6. Protein automated matches [254432] (4 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [257475] (2 PDB entries)

8. Domain d6ymxe1: 6ymx E:31-86 [393772]
   Other proteins in same PDB: d6ymxa1, d6ymxa2, d6ymxb1, d6ymxb2, d6ymxc_, d6ymxd1, d6ymxd2, d6ymxe2, d6ymxf_, d6ymxg_, d6ymxh_, d6ymxi_, d6ymxj_, d6ymxl1, d6ymxl2, d6ymxm1, d6ymxm2, d6ymxn1, d6ymxn2, d6ymxo1, d6ymxo2, d6ymxp2, d6ymxq_, d6ymxr_, d6ymxs_, d6ymxt_
   automated match to d3cx5e2
   complexed with 6ph, 7ph, 8pe, 9pe, cn3, cn5, cu, cua, fes, hea, hem, pcf, pty, uq6, zn

Details for d6ymxe1

PDB Entry: 6ymx, 3.17 Å

PDB Description: ciii2/civ respiratory supercomplex from saccharomyces cerevisiae

PDB Compounds: (E:) Cytochrome b-c1 complex subunit Rieske, mitochondrial

SCOPe Domain Sequences for d6ymxe1:

Sequence; same for both SEQRES and ATOM records:

>d6ymxe1 f.23.12.0 (E:31-86) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
kstyrtpnfddvlkenndadkgrsyayfmvgamgllssagakstvetfissmtata

Timeline for d6ymxe1:

• d6ymxe1 first appeared in SCOPe 2.07