SCOPe 2.08: Domain d6ymxn2: 6ymx N:262-385

Lineage for d6ymxn2 (6ymx N:262-385)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
   core: three transmembrane helices, up-and-down bundle

4. Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families)

5. Family f.32.1.0: automated matches [254197] (1 protein)
   not a true family

6. Protein automated matches [254431] (4 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [257469] (3 PDB entries)

8. Domain d6ymxn2: 6ymx N:262-385 [393697]
   Other proteins in same PDB: d6ymxa1, d6ymxa2, d6ymxb1, d6ymxb2, d6ymxc_, d6ymxd1, d6ymxd2, d6ymxe1, d6ymxe2, d6ymxf_, d6ymxg_, d6ymxh_, d6ymxi_, d6ymxj_, d6ymxl1, d6ymxl2, d6ymxm1, d6ymxm2, d6ymxn1, d6ymxo1, d6ymxo2, d6ymxp1, d6ymxp2, d6ymxq_, d6ymxr_, d6ymxs_, d6ymxt_
   automated match to d1kb9c1
   complexed with 6ph, 7ph, 8pe, 9pe, cn3, cn5, cu, cua, fes, hea, hem, pcf, pty, uq6, zn

Details for d6ymxn2

PDB Entry: 6ymx, 3.17 Å

PDB Description: ciii2/civ respiratory supercomplex from saccharomyces cerevisiae

PDB Compounds: (N:) cytochrome b

SCOPe Domain Sequences for d6ymxn2:

Sequence; same for both SEQRES and ATOM records:

>d6ymxn2 f.32.1.0 (N:262-385) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
plvtpasivpewyllpfyailrsipdkllgvitmfaailvllvlpftdrsvvrgntfkvl
skffffifvfnfvllgqigachvevpyvlmgqiatfiyfayfliivpvistienvlfyig
rvnk

Timeline for d6ymxn2:

• d6ymxn2 first appeared in SCOPe 2.07