Lineage for d6ymxi_ (6ymx I:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026015Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) (S)
    automatically mapped to Pfam PF05365
  5. 3026016Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins)
  6. 3026053Protein automated matches [190326] (4 species)
    not a true protein
  7. 3026056Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [187308] (5 PDB entries)
  8. 3026061Domain d6ymxi_: 6ymx I: [393725]
    Other proteins in same PDB: d6ymxa1, d6ymxa2, d6ymxb1, d6ymxb2, d6ymxc_, d6ymxd1, d6ymxd2, d6ymxe1, d6ymxe2, d6ymxf_, d6ymxg_, d6ymxh_, d6ymxj_, d6ymxl1, d6ymxl2, d6ymxm1, d6ymxm2, d6ymxn1, d6ymxn2, d6ymxo1, d6ymxo2, d6ymxp1, d6ymxp2, d6ymxq_, d6ymxr_, d6ymxs_
    automated match to d3cx5i_
    complexed with 6ph, 7ph, 8pe, 9pe, cn3, cn5, cu, cua, fes, hea, hem, pcf, pty, uq6, zn

Details for d6ymxi_

PDB Entry: 6ymx (more details), 3.17 Å

PDB Description: ciii2/civ respiratory supercomplex from saccharomyces cerevisiae
PDB Compounds: (I:) Cytochrome b-c1 complex subunit 9, mitochondrial

SCOPe Domain Sequences for d6ymxi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ymxi_ f.23.14.1 (I:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
slyktffkrnavfvgtifagafvfqtvfdtaitswyenhnkgklwkdvkariaa

SCOPe Domain Coordinates for d6ymxi_:

Click to download the PDB-style file with coordinates for d6ymxi_.
(The format of our PDB-style files is described here.)

Timeline for d6ymxi_: