Lineage for d6ymxg_ (6ymx G:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3027685Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 3027686Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) (S)
    location - matrix side of the bc1 complex
    automatically mapped to Pfam PF02271
  5. 3027687Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins)
    probably important for the complex assembly, caps the matrix face of cytochrome b
  6. 3027717Protein automated matches [190325] (4 species)
    not a true protein
  7. 3027720Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [187309] (5 PDB entries)
  8. 3027725Domain d6ymxg_: 6ymx G: [393703]
    Other proteins in same PDB: d6ymxa1, d6ymxa2, d6ymxb1, d6ymxb2, d6ymxc_, d6ymxd1, d6ymxd2, d6ymxe1, d6ymxe2, d6ymxf_, d6ymxh_, d6ymxi_, d6ymxj_, d6ymxl1, d6ymxl2, d6ymxm1, d6ymxm2, d6ymxn1, d6ymxn2, d6ymxo1, d6ymxo2, d6ymxp1, d6ymxp2, d6ymxq_, d6ymxs_, d6ymxt_
    automated match to d3cx5g_
    complexed with 6ph, 7ph, 8pe, 9pe, cn3, cn5, cu, cua, fes, hea, hem, pcf, pty, uq6, zn

Details for d6ymxg_

PDB Entry: 6ymx (more details), 3.17 Å

PDB Description: ciii2/civ respiratory supercomplex from saccharomyces cerevisiae
PDB Compounds: (G:) Cytochrome b-c1 complex subunit 7, mitochondrial

SCOPe Domain Sequences for d6ymxg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ymxg_ f.27.1.1 (G:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
pqsftsiarigdyilkspvlsklcvpvanqfinlagykklglkfddliaeenpimqtalr
rlpedesyarayriirahqtelthhllprnewikaqedvpyllpyileaeaaakekdeld
nievsk

SCOPe Domain Coordinates for d6ymxg_:

Click to download the PDB-style file with coordinates for d6ymxg_.
(The format of our PDB-style files is described here.)

Timeline for d6ymxg_: