SCOPe 2.08: Domain d6m4uf1: 6m4u F:2021-2113

Lineage for d6m4uf1 (6m4u F:2021-2113)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.7: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47212] (1 family)
   automatically mapped to Pfam PF08771

5. Family a.24.7.1: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47213] (2 proteins)

6. Protein automated matches [193175] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [193176] (5 PDB entries)

8. Domain d6m4uf1: 6m4u F:2021-2113 [391102]
   Other proteins in same PDB: d6m4ua_, d6m4ue1, d6m4ue2, d6m4uf2
   automated match to d2gaqa_
   complexed with cl, gol, rap, zn; mutant

Details for d6m4uf1

PDB Entry: 6m4u, 2.2 Å

PDB Description: crystal structure of fkbp-frb t2098l mutant in complex with rapamycin

PDB Compounds: (F:) Serine/threonine-protein kinase mTOR

SCOPe Domain Sequences for d6m4uf1:

Sequence; same for both SEQRES and ATOM records:

>d6m4uf1 a.24.7.1 (F:2021-2113) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ilwhemwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygrdlme
aqewcrkymksgnvkdllqawdlyyhvfrrisk

Timeline for d6m4uf1:

• d6m4uf1 first appeared in SCOPe 2.07