![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.7: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47212] (1 family) ![]() automatically mapped to Pfam PF08771 |
![]() | Family a.24.7.1: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47213] (2 proteins) |
![]() | Protein automated matches [193175] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [193176] (5 PDB entries) |
![]() | Domain d6m4uf1: 6m4u F:2021-2113 [391102] Other proteins in same PDB: d6m4ua_, d6m4ue1, d6m4ue2, d6m4uf2 automated match to d2gaqa_ complexed with cl, gol, rap, zn; mutant |
PDB Entry: 6m4u (more details), 2.2 Å
SCOPe Domain Sequences for d6m4uf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6m4uf1 a.24.7.1 (F:2021-2113) automated matches {Human (Homo sapiens) [TaxId: 9606]} ilwhemwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygrdlme aqewcrkymksgnvkdllqawdlyyhvfrrisk
Timeline for d6m4uf1:
![]() Domains from other chains: (mouse over for more information) d6m4ua_, d6m4ub_, d6m4ue1, d6m4ue2 |