| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.7: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47212] (1 family) ![]() automatically mapped to Pfam PF08771 |
| Family a.24.7.1: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47213] (2 proteins) |
| Protein automated matches [193175] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [193176] (5 PDB entries) |
| Domain d6m4ub_: 6m4u B: [391087] Other proteins in same PDB: d6m4ua_, d6m4ue1, d6m4ue2, d6m4uf2 automated match to d2gaqa_ complexed with cl, gol, rap, zn; mutant |
PDB Entry: 6m4u (more details), 2.2 Å
SCOPe Domain Sequences for d6m4ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6m4ub_ a.24.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ilwhemwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygrdlme
aqewcrkymksgnvkdllqawdlyyhvfrrisk
Timeline for d6m4ub_: