Lineage for d6m4ub_ (6m4u B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700001Superfamily a.24.7: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47212] (1 family) (S)
    automatically mapped to Pfam PF08771
  5. 2700002Family a.24.7.1: FKBP12-rapamycin-binding domain of FKBP-rapamycin-associated protein (FRAP) [47213] (2 proteins)
  6. 2700018Protein automated matches [193175] (1 species)
    not a true protein
  7. 2700019Species Human (Homo sapiens) [TaxId:9606] [193176] (5 PDB entries)
  8. 2700026Domain d6m4ub_: 6m4u B: [391087]
    Other proteins in same PDB: d6m4ua_, d6m4ue1, d6m4ue2, d6m4uf2
    automated match to d2gaqa_
    complexed with cl, gol, rap, zn; mutant

Details for d6m4ub_

PDB Entry: 6m4u (more details), 2.2 Å

PDB Description: crystal structure of fkbp-frb t2098l mutant in complex with rapamycin
PDB Compounds: (B:) Serine/threonine-protein kinase mTOR

SCOPe Domain Sequences for d6m4ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6m4ub_ a.24.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ilwhemwhegleeasrlyfgernvkgmfevleplhammergpqtlketsfnqaygrdlme
aqewcrkymksgnvkdllqawdlyyhvfrrisk

SCOPe Domain Coordinates for d6m4ub_:

Click to download the PDB-style file with coordinates for d6m4ub_.
(The format of our PDB-style files is described here.)

Timeline for d6m4ub_: