SCOPe 2.08: Domain d6m4ue1: 6m4u E:1-108

Lineage for d6m4ue1 (6m4u E:1-108)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.0: automated matches [191631] (1 protein)
   not a true family

6. Protein automated matches [191162] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225017] (17 PDB entries)

8. Domain d6m4ue1: 6m4u E:1-108 [391091]
   Other proteins in same PDB: d6m4ub_, d6m4ue2, d6m4uf1, d6m4uf2
   automated match to d4c02b_
   complexed with cl, gol, rap, zn; mutant

Details for d6m4ue1

PDB Entry: 6m4u, 2.2 Å

PDB Description: crystal structure of fkbp-frb t2098l mutant in complex with rapamycin

PDB Compounds: (E:) Peptidyl-prolyl cis-trans isomerase FKBP1A

SCOPe Domain Sequences for d6m4ue1:

Sequence; same for both SEQRES and ATOM records:

>d6m4ue1 d.26.1.0 (E:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgw
eegvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

Timeline for d6m4ue1:

• d6m4ue1 first appeared in SCOPe 2.07