Lineage for d6kbia3 (6kbi A:311-479)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2851636Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2851705Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2851922Family c.10.2.0: automated matches [191489] (1 protein)
    not a true family
  6. 2851923Protein automated matches [190787] (14 species)
    not a true protein
  7. 2851937Species Human (Homo sapiens) [TaxId:9606] [188042] (21 PDB entries)
  8. 2851972Domain d6kbia3: 6kbi A:311-479 [388514]
    Other proteins in same PDB: d6kbia2, d6kbia4
    automated match to d1m6ba2
    complexed with nag; mutant

Details for d6kbia3

PDB Entry: 6kbi (more details), 3 Å

PDB Description: crystal structure of erbb3 n418q mutant
PDB Compounds: (A:) Receptor tyrosine-protein kinase erbB-3

SCOPe Domain Sequences for d6kbia3:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kbia3 c.10.2.0 (A:311-479) automated matches {Human (Homo sapiens) [TaxId: 9606]}
acegtgsgsrfqtvdssnidgfvnctkilgnldflitglngdpwhkipaldpeklnvfrt
vreitgylniqswpphmhnfsvfsnlttiggrslynrgfsllimknlqvtslgfrslkei
sagriyisanrqlcyhhslnwtkvlrgpteerldikhnrprrdcvaegk

SCOPe Domain Coordinates for d6kbia3:

Click to download the PDB-style file with coordinates for d6kbia3.
(The format of our PDB-style files is described here.)

Timeline for d6kbia3: