SCOPe 2.08: Domain d6kbia1: 6kbi A:8-165

Lineage for d6kbia1 (6kbi A:8-165)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.0: automated matches [191489] (1 protein)
   not a true family

6. Protein automated matches [190787] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188042] (21 PDB entries)

8. Domain d6kbia1: 6kbi A:8-165 [388512]
   Other proteins in same PDB: d6kbia2, d6kbia4
   automated match to d1m6ba1
   complexed with nag; mutant

Details for d6kbia1

PDB Entry: 6kbi, 3 Å

PDB Description: crystal structure of erbb3 n418q mutant

PDB Compounds: (A:) Receptor tyrosine-protein kinase erbB-3

SCOPe Domain Sequences for d6kbia1:

Sequence, based on SEQRES records:

>d6kbia1 c.10.2.0 (A:8-165) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avcpgtlnglsvtgdaenqyqtlyklyercevvmgnleivltghnadlsflqwirevtgy
vlvamnefstlplpnlrvvrgtqvydgkfaifvmlnyntnsshalrqlrltqlteilsgg
vyiekndklchmdtidwrdivrdrdaeivvkdngrscp

Sequence, based on observed residues (ATOM records):

>d6kbia1 c.10.2.0 (A:8-165) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avcpgrcevvmgnleivltghnadlsflqwirevtgyvlvamnefstlplpnlrvvrgtq
vydgkfaifvmlnyntnsshalrqlrltqlteilsggvyiekndklchmdtidwrdivrd
rdaeivvkdngrscp

Timeline for d6kbia1:

• d6kbia1 first appeared in SCOPe 2.07