Lineage for d6kbia4 (6kbi A:480-580)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3030968Superfamily g.3.9: Growth factor receptor domain [57184] (2 families) (S)
  5. 3031041Family g.3.9.0: automated matches [232406] (1 protein)
    not a true family
  6. 3031042Protein automated matches [232407] (3 species)
    not a true protein
  7. 3031043Species Human (Homo sapiens) [TaxId:9606] [232408] (18 PDB entries)
  8. 3031080Domain d6kbia4: 6kbi A:480-580 [388515]
    Other proteins in same PDB: d6kbia1, d6kbia3
    automated match to d1m6ba4
    complexed with nag; mutant

Details for d6kbia4

PDB Entry: 6kbi (more details), 3 Å

PDB Description: crystal structure of erbb3 n418q mutant
PDB Compounds: (A:) Receptor tyrosine-protein kinase erbB-3

SCOPe Domain Sequences for d6kbia4:

Sequence; same for both SEQRES and ATOM records: (download)

>d6kbia4 g.3.9.0 (A:480-580) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vcdplcssggcwgpgpgqclscrnysrggvcvthcnflngeprefaheaecfschpecqp
megtatcngsgsdtcaqcahfrdgphcvsscphgvlgakgp

SCOPe Domain Coordinates for d6kbia4:

Click to download the PDB-style file with coordinates for d6kbia4.
(The format of our PDB-style files is described here.)

Timeline for d6kbia4: