PDB entry 6kbi

View 6kbi on RCSB PDB site
Description: Crystal structure of ErbB3 N418Q mutant
Class: signaling protein
Keywords: Receptor protein, tyrosine kinase, ErbB-3, SIGNALING PROTEIN
Deposited on 2019-06-25, released 2020-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-07-01, with a file datestamp of 2020-06-26.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Receptor tyrosine-protein kinase erbB-3
    Species: Homo sapiens [TaxId:9606]
    Gene: ERBB3, HER3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21860
      • engineered mutation (417)
    Domains in SCOPe 2.07: d6kbia1, d6kbia2, d6kbia3, d6kbia4
  • Chain 'B':
    Compound: Receptor tyrosine-protein kinase erbB-3
    Species: Homo sapiens [TaxId:9606]
    Gene: ERBB3, HER3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21860
      • engineered mutation (417)
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6kbiA (A:)
    sevgnsqavcpgtlnglsvtgdaenqyqtlyklyercevvmgnleivltghnadlsflqw
    irevtgyvlvamnefstlplpnlrvvrgtqvydgkfaifvmlnyntnsshalrqlrltql
    teilsggvyiekndklchmdtidwrdivrdrdaeivvkdngrscppchevckgrcwgpgs
    edcqtltkticapqcnghcfgpnpnqcchdecaggcsgpqdtdcfacrhfndsgacvprc
    pqplvynkltfqlepnphtkyqyggvcvascphnfvvdqtscvracppdkmevdknglkm
    cepcgglcpkacegtgsgsrfqtvdssnidgfvnctkilgnldflitglngdpwhkipal
    dpeklnvfrtvreitgylniqswpphmhnfsvfsnlttiggrslynrgfsllimknlqvt
    slgfrslkeisagriyisanrqlcyhhslnwtkvlrgpteerldikhnrprrdcvaegkv
    cdplcssggcwgpgpgqclscrnysrggvcvthcnflngeprefaheaecfschpecqpm
    egtatcngsgsdtcaqcahfrdgphcvsscphgvlgakgpiykypdvqnecrpchenctq
    gckgpelqdclgqtlvligk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6kbiA (A:)
    avcpgrcevvmgnleivltghnadlsflqwirevtgyvlvamnefstlplpnlrvvrgtq
    vydgkfaifvmlnyntnsshalrqlrltqlteilsggvyiekndklchmdtidwrdivrd
    rdaeivvkdngrscppchevckgrcwgpgsedcqtltkticapqcnghcfgpnpnqcchd
    ecaggcsgpqdtdcfacrhfndsgacvprcpqplvynkltfqlepnphtkyqyggvcvas
    cphnfvvdqtscvracppdkmevdknglkmcepcgglcpkacegtgsgsrfqtvdssnid
    gfvnctkilgnldflitglngdpwhkipaldpeklnvfrtvreitgylniqswpphmhnf
    svfsnlttiggrslynrgfsllimknlqvtslgfrslkeisagriyisanrqlcyhhsln
    wtkvlrgpteerldikhnrprrdcvaegkvcdplcssggcwgpgpgqclscrnysrggvc
    vthcnflngeprefaheaecfschpecqpmegtatcngsgsdtcaqcahfrdgphcvssc
    phgvlgakgp
    

  • Chain 'B':
    No sequence available.