SCOPe 2.08: Domain d6ro0i2: 6ro0 I:90-199

Lineage for d6ro0i2 (6ro0 I:90-199)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)

6. Protein automated matches [190381] (11 species)
   not a true protein

7. Species Bordetella pertussis [TaxId:520] [386828] (1 PDB entry)

8. Domain d6ro0i2: 6ro0 I:90-199 [387030]
   Other proteins in same PDB: d6ro0a_, d6ro0b1, d6ro0c1, d6ro0g_, d6ro0h1, d6ro0i1
   automated match to d1prtc1
   complexed with gol

Details for d6ro0i2

PDB Entry: 6ro0, 2.13 Å

PDB Description: crystal structure of genetically detoxified pertussis toxin gdpt.

PDB Compounds: (I:) Islet-activating protein S3

SCOPe Domain Sequences for d6ro0i2:

Sequence; same for both SEQRES and ATOM records:

>d6ro0i2 b.40.2.1 (I:90-199) automated matches {Bordetella pertussis [TaxId: 520]}
tiyktgqpaadhyyskvtatrllastnsrlcavfvrdgqsvigacaspyegryrdmydal
rrllymiymsglavrvhvskeeqyydyedatfqtyaltgislcnpaasic

Timeline for d6ro0i2:

• d6ro0i2 first appeared in SCOPe 2.07