![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) ![]() |
![]() | Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
![]() | Protein automated matches [190381] (11 species) not a true protein |
![]() | Species Bordetella pertussis [TaxId:520] [386828] (1 PDB entry) |
![]() | Domain d6ro0j_: 6ro0 J: [386957] Other proteins in same PDB: d6ro0a_, d6ro0b1, d6ro0c1, d6ro0g_, d6ro0h1, d6ro0i1 automated match to d1prtd_ complexed with gol |
PDB Entry: 6ro0 (more details), 2.13 Å
SCOPe Domain Sequences for d6ro0j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ro0j_ b.40.2.1 (J:) automated matches {Bordetella pertussis [TaxId: 520]} dvpyvlvktnmvvtsvamkpyevtptrmlvcgiaaklgaaasspdahvpfcfgkdlkrpg sspmevmlravfmqqrplrmflgpkqltfegkpalelirmvecsgkqdcp
Timeline for d6ro0j_: