Lineage for d6ro0a_ (6ro0 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000428Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 3000429Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 3000430Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)
  6. 3000572Protein automated matches [190133] (8 species)
    not a true protein
  7. 3000589Species Bordetella pertussis [TaxId:520] [386834] (1 PDB entry)
  8. 3000590Domain d6ro0a_: 6ro0 A: [386835]
    Other proteins in same PDB: d6ro0b1, d6ro0b2, d6ro0c1, d6ro0c2, d6ro0d_, d6ro0e_, d6ro0f_, d6ro0h1, d6ro0h2, d6ro0i1, d6ro0i2, d6ro0j_, d6ro0k_, d6ro0l_
    automated match to d1prta_
    complexed with gol

Details for d6ro0a_

PDB Entry: 6ro0 (more details), 2.13 Å

PDB Description: crystal structure of genetically detoxified pertussis toxin gdpt.
PDB Compounds: (A:) Pertussis toxin subunit 1

SCOPe Domain Sequences for d6ro0a_:

Sequence, based on SEQRES records: (download)

>d6ro0a_ d.166.1.1 (A:) automated matches {Bordetella pertussis [TaxId: 520]}
dppatvykydsrppedvfqngftawgnndnvlehltgrscqvgssnsafvstsssrryte
vylehrmqeaveaeragrgtghfigyiyevradnnfygaassyfeyvdtygdnagrilag
alatyqsgylahrrippenirrvtrvyhngitgetttteysnaryvsqqtranpnpytsr
rsvasivgtlvrmapvvgacmarqaesseamaawserageamvlvyyesiaysf

Sequence, based on observed residues (ATOM records): (download)

>d6ro0a_ d.166.1.1 (A:) automated matches {Bordetella pertussis [TaxId: 520]}
dppatvykydsrppedvfqngftawgnndnvlehltgrscqvgssnsafvstsssrryte
vylehrmqeaveaeragrgtghfigyiyevradnnfygaassyfeyvdtygdnagrilag
alatyqsgylahrrippenirrvtrvyhngitgetttteysnaryvsqqtranpnpytsr
rsvasivgtlvrmapvvgacmarqaesseeamvlvyyesiaysf

SCOPe Domain Coordinates for d6ro0a_:

Click to download the PDB-style file with coordinates for d6ro0a_.
(The format of our PDB-style files is described here.)

Timeline for d6ro0a_: