![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
![]() | Superfamily d.166.1: ADP-ribosylation [56399] (8 families) ![]() |
![]() | Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins) |
![]() | Protein automated matches [190133] (8 species) not a true protein |
![]() | Species Bordetella pertussis [TaxId:520] [386834] (1 PDB entry) |
![]() | Domain d6ro0a_: 6ro0 A: [386835] Other proteins in same PDB: d6ro0b1, d6ro0b2, d6ro0c1, d6ro0c2, d6ro0d_, d6ro0e_, d6ro0f_, d6ro0h1, d6ro0h2, d6ro0i1, d6ro0i2, d6ro0j_, d6ro0k_, d6ro0l_ automated match to d1prta_ complexed with gol |
PDB Entry: 6ro0 (more details), 2.13 Å
SCOPe Domain Sequences for d6ro0a_:
Sequence, based on SEQRES records: (download)
>d6ro0a_ d.166.1.1 (A:) automated matches {Bordetella pertussis [TaxId: 520]} dppatvykydsrppedvfqngftawgnndnvlehltgrscqvgssnsafvstsssrryte vylehrmqeaveaeragrgtghfigyiyevradnnfygaassyfeyvdtygdnagrilag alatyqsgylahrrippenirrvtrvyhngitgetttteysnaryvsqqtranpnpytsr rsvasivgtlvrmapvvgacmarqaesseamaawserageamvlvyyesiaysf
>d6ro0a_ d.166.1.1 (A:) automated matches {Bordetella pertussis [TaxId: 520]} dppatvykydsrppedvfqngftawgnndnvlehltgrscqvgssnsafvstsssrryte vylehrmqeaveaeragrgtghfigyiyevradnnfygaassyfeyvdtygdnagrilag alatyqsgylahrrippenirrvtrvyhngitgetttteysnaryvsqqtranpnpytsr rsvasivgtlvrmapvvgacmarqaesseeamvlvyyesiaysf
Timeline for d6ro0a_: