SCOPe 2.08: Domain d6ro0c1: 6ro0 C:3-89

Lineage for d6ro0c1 (6ro0 C:3-89)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (21 species)
   not a true protein

7. Species Bordetella pertussis [TaxId:520] [386856] (1 PDB entry)

8. Domain d6ro0c1: 6ro0 C:3-89 [386857]
   Other proteins in same PDB: d6ro0a_, d6ro0b1, d6ro0b2, d6ro0c2, d6ro0d_, d6ro0e_, d6ro0f_, d6ro0g_, d6ro0h1, d6ro0h2, d6ro0i2, d6ro0j_, d6ro0k_, d6ro0l_
   automated match to d1prtc2
   complexed with gol

Details for d6ro0c1

PDB Entry: 6ro0, 2.13 Å

PDB Description: crystal structure of genetically detoxified pertussis toxin gdpt.

PDB Compounds: (C:) Islet-activating protein S3

SCOPe Domain Sequences for d6ro0c1:

Sequence; same for both SEQRES and ATOM records:

>d6ro0c1 d.169.1.0 (C:3-89) automated matches {Bordetella pertussis [TaxId: 520]}
pgivippkalftqqggaygrcpngtraltvaelrgnaelqtylrqitpgwsiyglydgty
lgqayggiikdappgagfiyretfcit

Timeline for d6ro0c1:

• d6ro0c1 first appeared in SCOPe 2.07