![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.2: Aerolysin/Pertussis toxin (APT) domain [56467] (3 proteins) automatically mapped to Pfam PF03440 |
![]() | Protein automated matches [386878] (1 species) not a true protein |
![]() | Species Bordetella pertussis [TaxId:520] [386879] (1 PDB entry) |
![]() | Domain d6ro0h1: 6ro0 H:1-89 [386978] Other proteins in same PDB: d6ro0a_, d6ro0b2, d6ro0c1, d6ro0c2, d6ro0d_, d6ro0e_, d6ro0f_, d6ro0g_, d6ro0h2, d6ro0i1, d6ro0i2, d6ro0j_, d6ro0k_, d6ro0l_ automated match to d1bcpb2 complexed with gol |
PDB Entry: 6ro0 (more details), 2.13 Å
SCOPe Domain Sequences for d6ro0h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6ro0h1 d.169.1.2 (H:1-89) automated matches {Bordetella pertussis [TaxId: 520]} stpgivippqeqitqhgspygrcanktraltvaelrgsgdlqeylrhvtrgwsifalydg tylggeyggvikdgtpggafdlkttfcim
Timeline for d6ro0h1: