SCOP 1.55: Domain d1c8ub2: 1c8u B:116-286

Lineage for d1c8ub2 (1c8u B:116-286)

1. Root: SCOP 1.55

2. Class d: Alpha and beta proteins (a+b) [53931] (184 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (3 families)

5. Family d.38.1.3: Thioesterase II (TesB) [54644] (1 protein)

6. Protein Thioesterase II (TesB) [54645] (1 species)

7. Species Escherichia coli [TaxId:562] [54646] (1 PDB entry)

8. Domain d1c8ub2: 1c8u B:116-286 [38550]

Details for d1c8ub2

PDB Entry: 1c8u, 1.9 Å

PDB Description: crystal structure of the e.coli thioesterase ii, a homologue of the human nef-binding enzyme

SCOP Domain Sequences for d1c8ub2:

Sequence; same for both SEQRES and ATOM records:

>d1c8ub2 d.38.1.3 (B:116-286) Thioesterase II (TesB) {Escherichia coli}
ehqktmpsapapdglpsetqiaqslahllppvlkdkficdrplevrpvefhnplkghvae
phrqvwirangsvpddlrvhqyllgyasdlnflpvalqphgigflepgiqiatidhsmwf
hrpfnlnewllysvestsassargfvrgefytqdgvlvastvqegvmrnhn

Timeline for d1c8ub2:

• d1c8ub2 appears in SCOP 1.57
  
• d1c8ub2 appears in the current release, SCOPe 2.08