Lineage for d1c8ub2 (1c8u B:116-286)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79342Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
  4. 79343Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (3 families) (S)
  5. 79355Family d.38.1.3: Thioesterase II (TesB) [54644] (1 protein)
  6. 79356Protein Thioesterase II (TesB) [54645] (1 species)
  7. 79357Species Escherichia coli [TaxId:562] [54646] (1 PDB entry)
  8. 79361Domain d1c8ub2: 1c8u B:116-286 [38550]

Details for d1c8ub2

PDB Entry: 1c8u (more details), 1.9 Å

PDB Description: crystal structure of the e.coli thioesterase ii, a homologue of the human nef-binding enzyme

SCOP Domain Sequences for d1c8ub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c8ub2 d.38.1.3 (B:116-286) Thioesterase II (TesB) {Escherichia coli}
ehqktmpsapapdglpsetqiaqslahllppvlkdkficdrplevrpvefhnplkghvae
phrqvwirangsvpddlrvhqyllgyasdlnflpvalqphgigflepgiqiatidhsmwf
hrpfnlnewllysvestsassargfvrgefytqdgvlvastvqegvmrnhn

SCOP Domain Coordinates for d1c8ub2:

Click to download the PDB-style file with coordinates for d1c8ub2.
(The format of our PDB-style files is described here.)

Timeline for d1c8ub2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1c8ub1